a2m2html output for tmp.a2m

Citations (SAM, SAM-T99, HMMs)

R. Hughey, A. Krogh, Hidden Markov models for sequence analysis: Extension and analysis of the basic method, CABIOS 12:95-107, 1996.
K. Karplus, C. Barrett, R. Hughey, Hidden Markov models for detecting remote protein homologies, Bioinformatics 14(10):846-856, 1998.
A. Krogh et al., Hidden Markov models in computational biology: Applications to protein modeling, JMB 235:1501-1531, Feb 1994.

Sequence numbers correspond to the following labels:

- YBR221W-A Annotated|02:666533:666637| frame 2; YBR221W-A; Uncharacterized; this gene contains 1 exon
- gi|33438772|ref|NP_878054.1|_1:34 Putative protein of unknown function; identified by expression profiling and mass spectrometry; Ybr221w-ap [Saccharomyces cerevisiae]

              10        20        30    
              |         |         |    
   1 MFSHFEVSENRPRKQPRRKRISLGMINTVVSLDR
   2 MFSHFEVSENRPRKQPRRKRISLGMINTVVSLDR